PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00023800-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 571aa    MW: 61851.2 Da    PI: 7.0319
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00023800-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093724091954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  SMil_00023800-RA_Salv 372 FEHflHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 409
                            554459******************************88 PP

2BELL99.62.4e-32242310472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            +  +kk++Lls+l+eV+krYkqy++q+q+ +++Fe vagl  a+p+++lAlka+S+hFr+Lk+ai++q+
  SMil_00023800-RA_Salv 242 DQTRKKSRLLSMLDEVYKRYKQYYQQMQAAVAAFESVAGLSGAAPFANLALKAMSKHFRSLKNAITDQL 310
                            5679**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-50179308IPR006563POX domain
PfamPF075263.8E-36184307IPR006563POX domain
PROSITE profilePS5007112.098350413IPR001356Homeobox domain
CDDcd000866.97E-13353414No hitNo description
SMARTSM003897.3E-10353417IPR001356Homeobox domain
SuperFamilySSF466896.84E-17355420IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-27356417IPR009057Homeodomain-like
PfamPF059201.4E-18370409IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
LRVVNHHPPG CVDSLQTCAA LVPLYDPSLI PPDFINCATL QQRQSYNLAA AGVKEEGVNF  60
MGFSGGMGAN HMYADPQHLS VHLNPSTIHD IYASYRGGGV FDQPFHGGGD APATPSGAGQ  120
SLSLSLSSHH SNLPLELNLQ RYDSPVFSGG KVSEGYLVSC NGGAGAELSK SSVPLGPFTG  180
YASVLKGSRF LKPAQQLLEE LCDVGRGIYS EKSGADSSLL DPPPLESFSG SEIVDDSVAN  240
GDQTRKKSRL LSMLDEVYKR YKQYYQQMQA AVAAFESVAG LSGAAPFANL ALKAMSKHFR  300
SLKNAITDQL HFTSKSHGKI NVDRDETQRL ENSGRGSYGQ RPFHAGFADQ PVWRPQRGLP  360
ERAVTVLRAW LFEHFLHPYP TDTDKLMLAK QTGLSRNQVS NWFINARVRL WKPMVEEIHM  420
LETRQSQKGS QREEGSDHLP TSCSVEGENA STSIQRSGDF PLKRCREDPT EAPGGGVGQQ  480
MKMPYDNLLH NPHHNMGAGL SSGGGGSSGV SLTLGLHQNG VGLPDSYPLN AARRFGLDSH  540
GESYVVSGFA AQNRQFGRDI IDGQIMHDFV G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A5e-17359417159Homeobox protein Meis2
5bng_B5e-17359417159Homeobox protein Meis2
4xrs_B6e-17359416158Homeobox protein Meis1
4xrs_A6e-17359416158Homeobox protein Meis1
4xrm_B7e-17359417563Homeobox protein Meis2
4xrm_A7e-17359417563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094923.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X1
SwissprotQ9LZM81e-115BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-88TALE family protein